SURMOUNT-1: once-weekly tirzepatide (5/10/15 mg) produced mean weight reductions of 15-20.9% at 72 weeks in adults with obesity, versus 3.1% with placebo.
Tirzepatide
Dual GLP-1/GIP receptor agonist with superior weight loss efficacy

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Tirzepatide is FDA-approved (Mounjaro 2022 for type 2 diabetes; Zepbound November 2023 for obesity). SURMOUNT-1 reported mean weight reductions up to ~20.9% at 72 weeks at the highest dose; SURPASS trials showed superior HbA1c reduction versus placebo and comparators in type 2 diabetes.
Preclinical studies characterize the effects of dual GIP/GLP-1 agonism on body weight, food intake and glycemic control.
Cell-based studies characterize GIP and GLP-1 receptor co-agonism.
Ongoing trials (SURMOUNT-OSA, cardiovascular outcomes SURPASS-CVOT, MASH indications) will clarify broader effects; muscle-mass changes and long-term durability remain areas of active study.
Key Studies & Findings
FDA approved tirzepatide (Zepbound) for chronic weight management in adults with obesity or overweight plus at least one weight-related comorbidity.
Benefits & Effects
Dual agonist (GLP-1
GIP)
Superior weight loss vs Semaglutide
Blood sugar control.
Dual agonist (GLP-1
GIP)
Superior weight loss vs Semaglutide
Blood sugar control.
Side Effects & Safety
Interaction
Avoid: DPP-4 inhibitors
Interaction
Avoid: DPP-4 inhibitors
Mild-Moderate side effect
Onset: Days
Management: Slow dose escalation
Dose-dependent
Mild-Moderate side effect
Onset: Days
Management: Hydration
Dose-dependent
Mild-Moderate side effect
Onset: Days
Management: Antiemetics
Dose-dependent
Moderate-Severe side effect
Onset: Hours
Management: Reduce concomitant meds
Dose-dependent
Severe side effect
Onset: Unknown
Management: CONTRAINDICATED with MTC/MEN2
Dose-dependent
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
2.5-15 mg Weekly
Research Protocols
Weight loss initiation
- Dose
- 2.5mg weekly
- Frequency
- Once weekly
- Route
- SubQ injection
Weight loss progression
- Dose
- 5mg weekly
- Frequency
- Once weekly
- Route
- SubQ injection
Weight loss optimization
- Dose
- 7.5-10mg weekly
- Frequency
- Once weekly
- Route
- SubQ injection
Maximum weight loss
- Dose
- 12.5-15mg weekly
- Frequency
- Once weekly
- Route
- SubQ injection
Diabetes management (mild)
- Dose
- 5-7.5mg weekly
- Frequency
- Once weekly
- Route
- SubQ injection
Diabetes management (severe)
- Dose
- 10-15mg weekly
- Frequency
- Once weekly
- Route
- SubQ injection
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
What is the difference between tirzepatide and semaglutide?
Tirzepatide is a dual GIP/GLP-1 receptor agonist while semaglutide is a GLP-1 agonist; head-to-head trials showed greater HbA1c reduction and weight loss with tirzepatide.
Is tirzepatide approved for weight loss?
Yes — as Zepbound (November 2023) for chronic weight management in adults with obesity, or overweight with at least one weight-related comorbidity.
Research Citations
Aronne LJ, Sattar N, Horn DB, Bays HE, Wharton S, Lin WY, Ahmad NN, Zhang S, Liao R, Bunck MC, Jouravskaya I, Murphy MA, SURMOUNT-4 Investigators (2024)
Frías JP, Davies MJ, Rosenstock J, Pérez Manghi FC, Fernández Landó L, Bergman BK, Liu B, Cui X, Brown K, SURPASS-2 Investigators (2021)
+ 20 more citations
Related Resources
Quick Facts
Formula
C225H348N48O68
Molecular Weight
4813.45
Sequence
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Mechanism
Dual GLP-1/GIP receptor agonist for enhanced metabolic effects
Safety Information
FDA approved. Most common side effects are GI-related and typically mild to moderate.
Citations
25Aronne LJ, Sattar N, Horn DB, Bays HE, Wharton S, Lin WY, Ahmad NN, Zhang S, Liao R, Bunck MC, Jouravskaya I, Murphy MA, SURMOUNT-4 Investigators (2024)
Frías JP, Davies MJ, Rosenstock J, Pérez Manghi FC, Fernández Landó L, Bergman BK, Liu B, Cui X, Brown K, SURPASS-2 Investigators (2021)
+ 20 more citations