In a randomized, double-blind trial in HIV patients with lipodystrophy, tesamorelin significantly reduced visceral adipose tissue compared with placebo while preserving subcutaneous fat.
Tesamorelin
GHRH analog FDA-approved for HIV-associated lipodystrophy

WADA BANNED - Prohibited in competitive sports as growth hormone releasing agent
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: FDA approved
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Tesamorelin is FDA approved (Egrifta, 2010) to reduce excess abdominal (visceral) fat in HIV patients with lipodystrophy. The pivotal randomized trial (NEJM 2007) showed significant reductions in visceral adipose tissue with preservation of subcutaneous fat; later randomized work found reduced hepatic fat in HIV-associated NAFLD.
Preclinical studies of GHRH analogs in animal models support the mechanism of endogenous GH stimulation and effects on fat distribution.
Cell-based pharmacology characterizes tesamorelin as a GHRH analog that activates the pituitary GHRH receptor to stimulate endogenous GH secretion.
Off-label uses — age-related body-composition changes, NAFLD in non-HIV patients, and cognitive effects in aging (e.g., in older adults with mild cognitive impairment) — remain investigational, with early-stage or mixed data.
Key Studies & Findings
In HIV-associated NAFLD, analysis of liver biopsies from a randomized tesamorelin trial showed the drug shifted hepatic transcriptomic signatures, consistent with improvement of disease-related gene-expression programs.
The FDA approved tesamorelin (Egrifta) in 2010 as the first treatment for HIV-associated lipodystrophy (excess abdominal fat).
Benefits & Effects
Visceral fat reduction: -34 cm² vs +8 cm² placebo (p=0.005)
Hepatic fat reduction: -4.1% absolute reduction (p=0.018)
First FDA-approved treatment for HIV-associated lipodystrophy
Side Effects & Safety
Injection site reactions
Arthralgia (joint pain)
Headache
Peripheral edema
Transient glucose elevation (9 mg/dL increase at 2 weeks)
Mild side effect
Onset: Immediate
Management: Rotate sites
Mild-Moderate side effect
Onset: Days-weeks
Management: Analgesics
Dose-dependent
Mild-Moderate side effect
Onset: Hours-days
Management: Discontinue if severe
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
2 mg Daily
Research Protocols
HIV Lipodystrophy (FDA Approved)
- Dose
- 1.4 mg daily
- Frequency
- Once daily
- Route
- Subcutaneous injection (abdomen)
Visceral Fat Reduction
- Dose
- 2 mg daily
- Frequency
- Once daily
- Route
- Subcutaneous injection (rotate sites)
Anti-aging/Body Composition
- Dose
- 1-2 mg daily
- Frequency
- 5-7 days/week
- Route
- Subcutaneous injection (evening)
NAFLD Treatment
- Dose
- 2 mg daily
- Frequency
- Once daily
- Route
- Subcutaneous injection for 12 months
Cognitive Enhancement (Research)
- Dose
- 1 mg daily
- Frequency
- Once daily
- Route
- Subcutaneous injection for 20 weeks
Research Protocol
- Dose
- 1-2 mg daily
- Frequency
- Daily
- Route
- Subcutaneous with cycle breaks
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
What is tesamorelin approved for?
Reducing excess abdominal (visceral) fat in HIV-infected patients with lipodystrophy (brand name Egrifta, approved 2010).
Is tesamorelin the same as growth hormone?
No — it is a GHRH analog that stimulates the pituitary to secrete the body's own growth hormone, unlike direct GH administration.
Is tesamorelin approved for weight loss in general?
No. Use for general weight loss, aging, or NASH outside the HIV indication is off-label and investigational.
Research Citations
Dhillon S (2011)
Tesamorelin.
Unknown (2012)
Wang Y, Tomlinson B (2009)
+ 18 more citations
Related Resources
Quick Facts
Formula
C221H364N72O67S
Molecular Weight
5135.86
Sequence
MAADSQTPWLLTFSLLCLLWPQEAGAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKEEAQQRTDMELLRFSLLLIQSWLGPVQFLSRIFTNSLMFGTSDRVYEKLKDLEEGIQALMQELEDGSPRIGQILKQTYDKFDANMRSDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFAESSCAF
Mechanism
GHRH analogue that reduces visceral fat
Safety Information
FDA approved with established safety profile for HIV-associated lipodystrophy.
Citations
23Dhillon S (2011)
3.Tesamorelin.
Unknown (2012)
Dhillon S (2011)
Wang Y, Tomlinson B (2009)
+ 18 more citations