Phase 2 dose-finding trial: survodutide 4.8 mg/week achieved about 14.9% mean weight loss at 46 weeks vs about 2.8% with placebo; the most common adverse events were gastrointestinal (nausea, vomiting, diarrhea).
Survodutide
Dual GLP-1/glucagon receptor agonist in development for metabolic diseases

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Phase 2 Clinical Trials - GLP-1/Glucagon dual agonist
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
In a Phase 2 dose-finding trial in obesity, survodutide up to 4.8 mg weekly produced about 14.9% mean weight loss at 46 weeks versus about 2.8% with placebo. In a Phase 2 MASH trial, up to 83% of patients at the 4.8 mg dose achieved MASH resolution without worsening of fibrosis. Phase 3 programs in obesity and MASH are ongoing; the drug is not yet approved.
Mechanistic reviews of the dual-agonist class describe increased energy expenditure from glucagon agonism added to GLP-1 in obese rodent models, reducing body weight and liver fat beyond GLP-1 alone.
Survodutide is a balanced peptide dual agonist at the GLP-1 and glucagon (GCG) receptors.
Long-term cardiovascular outcomes, effects on hard MASH endpoints (cirrhosis, mortality), and Phase 3 efficacy and safety results are still pending.
Key Studies & Findings
Phase 2 MASH trial: up to 83% of patients receiving 4.8 mg weekly achieved MASH resolution without worsening of fibrosis (vs 18.2% with placebo).
Benefits & Effects
Side Effects & Safety
Mild-Moderate side effect
Onset: Days
Management: Slower dose escalation
Dose-dependent
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
Under clinical investigation, consult healthcare provider
Research Protocols
Obesity - Conservative Start
- Dose
- 0.6mg titrated over 24 weeks
- Frequency
- Once weekly with 4-week intervals
- Route
- Subcutaneous
Obesity - Standard Protocol
- Dose
- 3.6-6.0mg
- Frequency
- Once weekly
- Route
- Subcutaneous (abdomen/thigh)
MASH Treatment
- Dose
- 2.4-4.8mg
- Frequency
- Once weekly
- Route
- Subcutaneous
Type 2 Diabetes
- Dose
- 0.3-2.7mg
- Frequency
- Once weekly
- Route
- Subcutaneous
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Is survodutide approved?
No. It is an investigational drug (Boehringer Ingelheim) with positive Phase 2 results in obesity and MASH; Phase 3 trials are ongoing.
How does survodutide differ from semaglutide?
Survodutide activates both the GLP-1 and glucagon receptors (a dual agonist), adding a glucagon-mediated energy-expenditure component, whereas semaglutide activates GLP-1 only.
Research Citations
Alberto Martínez-Castelao, José Luis Górriz, Beatriz Fernández-Fernández, María José Soler, Juan F Navarro-González (2025)
Riad Mohammed Abdelrahman, Taha Hussein Musa, Ismail Adam Arbab, Mohsen Hussein Suliman, Eltieb Omer Ahmed (2025)
Carel W le Roux, Sean Wharton, Biykem Bozkurt, Elke Platz, Gabriele Bleckert (2026)
Sanyal AJ, Bedossa P, Fraessdorf M, Neff GW, Lawitz E, Bugianesi E, Anstee QM, Hussain SA, Newsome PN, Ratziu V, Hosseini-Tabatabaei A, Schattenberg JM, Noureddin M, Alkhouri N, Younes R, 1404-0043 Trial Investigators (2024)
le Roux CW, Steen O, Lucas KJ, Startseva E, Unseld A, Hennige AM (2024)
+ 22 more citations
Related Resources
Quick Facts
Formula
C192H289N47O61
Molecular Weight
4.5
Sequence
MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Mechanism
Dual agonist targeting GLP-1 and glucagon receptors for synergistic effects
Safety Information
Investigational drug in clinical trials. Not approved for use outside of clinical studies.
Citations
27Alberto Martínez-Castelao, José Luis Górriz, Beatriz Fernández-Fernández, María José Soler, Juan F Navarro-González (2025)
Riad Mohammed Abdelrahman, Taha Hussein Musa, Ismail Adam Arbab, Mohsen Hussein Suliman, Eltieb Omer Ahmed (2025)
Carel W le Roux, Sean Wharton, Biykem Bozkurt, Elke Platz, Gabriele Bleckert (2026)
Sanyal AJ, Bedossa P, Fraessdorf M, Neff GW, Lawitz E, Bugianesi E, Anstee QM, Hussain SA, Newsome PN, Ratziu V, Hosseini-Tabatabaei A, Schattenberg JM, Noureddin M, Alkhouri N, Younes R, 1404-0043 Trial Investigators (2024)
le Roux CW, Steen O, Lucas KJ, Startseva E, Unseld A, Hennige AM (2024)
+ 22 more citations