Nicotinamide riboside (1,000 mg/day for 6 weeks) was well tolerated and significantly elevated blood NAD+ in healthy middle-aged and older adults.
NAD-plus
Essential coenzyme for cellular energy and DNA repair

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Supplement - Cellular cofactor
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Oral NAD+ precursors are well tolerated and raise NAD+ levels in humans (Martens et al. 2018). A randomized trial found NMN improved muscle insulin sensitivity in prediabetic postmenopausal women (Yoshino et al. 2021). Newer studies (e.g., NAD-Brain, 2026) are probing NAD+ augmentation in blood and brain in Parkinson's disease.
Rodent studies show NAD+ precursors improve mitochondrial function, metabolism and healthspan-related phenotypes; effects on lifespan remain debated.
Cell studies demonstrate the NAD+ dependence of sirtuin and PARP (DNA repair) enzymes and of mitochondrial function.
Anti-aging and longevity claims in humans remain unproven; NAD+ precursors are not FDA-approved drugs; long-term safety and efficacy for age-related disease are not established.
Key Studies & Findings
In a randomized trial, NMN (250 mg/day for 10 weeks) increased muscle insulin sensitivity in postmenopausal women with prediabetes.
NAD-Brain study reports pharmacokinetics of NAD+ augmentation in blood and brain using oral precursor supplementation in a Parkinson's disease context.
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
100-500mg daily
Research Protocols
General Wellness & Energy
- Dose
- 100-250mg
- Frequency
- 1-2x weekly
- Route
- IV or IM
Anti-Aging Protocol
- Dose
- 250-500mg
- Frequency
- 2-3x weekly
- Route
- IV infusion
Cognitive Enhancement
- Dose
- 500-1000mg
- Frequency
- 1-2x weekly
- Route
- IV infusion
Athletic Performance
- Dose
- 250-500mg
- Frequency
- 2x weekly
- Route
- IM injection
Recovery & Repair
- Dose
- 500-1000mg
- Frequency
- 3x weekly
- Route
- IV infusion
Maintenance Therapy
- Dose
- 100-250mg
- Frequency
- 1x weekly
- Route
- SubQ or IM
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Does NAD+ supplementation slow aging?
Preclinical data are promising, but no human trial has shown anti-aging or lifespan effects; current evidence supports safety and NAD+-raising, not a proven longevity benefit.
Are NMN/NR supplements FDA-approved?
No. They are sold as dietary supplements in the US and are not approved as drugs.
Research Citations
Anand VD, Carper WR (1971)
Leonardo MR, Dailly Y, Clark DP (1996)
Gao M, Guan Y, Yue X, Bao H, Li Q, Zheng Y, Ou Y, Yang H (2025)
Winberg JO, McKinley-McKee JS (1988)
Kinetic behaviour of NAD plus-specific isocitrate dehydrogenase from baker's yeast and inhibition by AMP.
Cennamo C, Razzoli L, Ferrari F (1970)
+ 42 more citations
Related Resources
Quick Facts
Formula
C21H27N7O14P2
Molecular Weight
663.43
Sequence
MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
Mechanism
Cellular energy metabolism and DNA repair
Safety Information
Generally considered safe as a supplement. Consult healthcare provider for appropriate dosing.
Citations
47Anand VD, Carper WR (1971)
Leonardo MR, Dailly Y, Clark DP (1996)
Gao M, Guan Y, Yue X, Bao H, Li Q, Zheng Y, Ou Y, Yang H (2025)
Winberg JO, McKinley-McKee JS (1988)
5.Kinetic behaviour of NAD plus-specific isocitrate dehydrogenase from baker's yeast and inhibition by AMP.
Cennamo C, Razzoli L, Ferrari F (1970)
+ 42 more citations