Skip to main content
WADA Banned 3 views

MGF (Mechano Growth Factor)

Mechano growth factor for muscle tissue repair after exercise

MGF (Mechano Growth Factor) molecular structure

WADA BANNED - Prohibited in competitive sports as growth factor

Overview

MGF (Mechano Growth Factor) is a splice variant of insulin-like growth factor-1 (IGF-1) produced locally in skeletal muscle in response to mechanical stress, damage, or exercise. The MGF E-peptide domain differs from systemic IGF-1Ea, giving it unique local autocrine/paracrine functions. Research demonstrates MGF specifically activates muscle satellite cells—the resident stem cells responsible for muscle fiber repair and growth—initiating their proliferation before they differentiate into mature myocytes. This sequential process is critical for effective muscle regeneration. Studies show MGF expression peaks shortly after exercise or injury, preceding IGF-1Ea upregulation. The peptide may enhance muscle hypertrophy, accelerate recovery from exercise, and support tissue repair. PEG-MGF is a pegylated variant with extended half-life allowing systemic effects. Research continues into applications for sarcopenia, muscle wasting diseases, and injury recovery. MGF represents the local muscle tissue's immediate response to mechanical signals, distinct from liver-derived circulating IGF-1.

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

Mechano Growth FactorIGF-1EcIGF-I EcMGF E-peptide

Status: Research compound - IGF-1 splice variant

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

Muscle hypertrophy and regenerationSatellite cell biologyExercise-induced muscle adaptationSarcopenia research

Available Evidence

Human

Human evidence is observational: muscle biopsy studies show the MGF (IGF-1Ec) splice variant is upregulated in skeletal muscle after resistance exercise and injury. No interventional clinical trials of MGF peptide administration in humans were identified.

Animal

Animal work (largely from the Goldspink group) links MGF expression to muscle satellite-cell activation and regenerative responses after mechanical loading and injury.

In Vitro

An in-vitro study with human muscle progenitor cells found that the MGF E-peptide activated these cells and increased their fusion potential, including in cells from older donors.

Uncertain

Benefits of injected MGF or PEG-MGF (muscle growth, recovery) are not supported by clinical trials; PEG-MGF's extended-duration claims lack published human pharmacokinetic data.

Key Studies & Findings

1 studies

Benefits & Effects

6 documented

Muscle growth and repair

anecdotal

Enhanced recovery

anecdotal

Satellite cell activation

anecdotal

Improved muscle fiber regeneration

anecdotal

Post-workout recovery

anecdotal

Strength gains

anecdotal

Side Effects & Safety

3 reported

Local pain

MildUncommon

Hypoglycemia-like symptoms

MildUncommon

Rare abnormal tissue growth

SevereRare

Limitations & Open Questions

MGF is an endogenous splice variant, not an approved drug. Exogenous MGF peptide use has no clinical trial support; human data are limited to expression measurements in muscle biopsies. Half-life and dosing claims for MGF/PEG-MGF are not established in reliable published sources.

Pharmacology

MGF is the IGF-1Ec splice variant expressed locally in skeletal muscle after mechanical loading; the E-peptide domain activates muscle progenitor cells in culture. As a research peptide it is administered by injection, with pegylated (PEG-MGF) forms proposed to extend duration — neither has published human pharmacokinetic characterization.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

200mcg post-workout

Route: IM (local)
Half-life: 5-7 minutes

Frequently Asked Questions

What is MGF?

Mechano growth factor (IGF-1Ec) is a locally produced splice variant of IGF-1 that rises in skeletal muscle after exercise or injury and is linked to satellite-cell activation.

Is MGF FDA approved?

No. It is an unapproved research peptide.

Does MGF build muscle in humans?

There is no clinical trial evidence that injected MGF builds muscle in humans; the peptide's role is established only as an endogenous, exercise-responsive factor.

Research Citations

4
MgF(2):Mn(2+): novel material with mechanically-induced luminescence.

Ning J, Zheng Y, Ren Y, Li L, Shi X, Peng D, Yang Y (2022)

5
Mechanochemical coupling of MGF mediates periodontal regeneration.

Zhao Y, Zhang S, Cheng B, Feng F, Zhu Y, Liu Y, Wang J, Zou D, Ma H, Xu F, Zhang M (2024)

+ 47 more citations

Related Resources

Quick Facts

Formula

F3Mg-

Molecular Weight

2888.16

Sequence

MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK

Mechanism

Muscle-specific IGF-1 variant for localized muscle repair and growth

Safety Information

Research compound only. Limited human safety data available.

View All Peptides