LL-37 cream significantly enhanced healing of diabetic foot ulcers in a randomized double-blind controlled trial.
LL-37
Antimicrobial peptide with immune and healing properties

WADA BANNED - Prohibited in competitive sports as immune modulating peptide
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Research compound - Antimicrobial peptide
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
A randomized, double-blind, placebo-controlled trial found LL-37 cream enhanced healing of diabetic foot ulcers (Arch Dermatol Res 2023). A multicentric randomized placebo-controlled trial also reported LL-37 was safe and effective in enhancing healing of hard-to-heal venous leg ulcers (Wound Repair Regen 2021).
In animal wound models (e.g., diabetic mice), LL-37 accelerates wound closure and reduces bacterial burden, and it improves outcomes in infection models.
LL-37 has broad-spectrum antimicrobial activity (bacteria, fungi, viruses) via membrane disruption, neutralizes lipopolysaccharide, and modulates immune-cell chemotaxis and cytokine responses.
Systemic antimicrobial or anti-cancer applications remain experimental; clinical evidence is limited to topical wound-healing studies, and intranasal/systemic trials are preliminary.
Key Studies & Findings
LL-37 was safe and effective in enhancing healing of hard-to-heal venous leg ulcers in a multicentric prospective randomized placebo-controlled trial.
Benefits & Effects
68% mean ulcer area decrease at 0.5 mg/mL
Enhanced granulation in diabetic foot ulcers
Significant improvement in large ulcers (≥10 cm²)
Broad-spectrum antimicrobial activity
Side Effects & Safety
Well tolerated; no significant local or systemic adverse events
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
50-200mcg daily
Research Protocols
Chronic Venous Ulcers
- Dose
- 0.5 mg/mL
- Frequency
- Twice weekly
- Route
- Topical gel application
Diabetic Foot Ulcers
- Dose
- 0.5-1.6 mg/mL
- Frequency
- Daily application
- Route
- Topical cream
Acute Wound Healing
- Dose
- 1.6 mg/mL
- Frequency
- Once daily
- Route
- Topical gel or cream
Pressure Ulcer Treatment
- Dose
- 0.5-1.0 mg/mL
- Frequency
- Twice daily
- Route
- Hydrogel delivery system
Burn Wound Care
- Dose
- 1.0 mg/mL
- Frequency
- Once to twice daily
- Route
- Topical gel application
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Is LL-37 approved as a medicine?
No. LL-37 is an endogenous antimicrobial peptide studied in clinical trials for wound healing, but no LL-37 product is FDA-approved.
Does LL-37 kill bacteria?
It has broad-spectrum antimicrobial activity in lab studies, and topical trials show benefit in chronic wounds, but it is not a conventional antibiotic.
Research Citations
Mo Ahamad Khan, Lechen Zhu, Hu Zhu (2025)
Alireza Neshani, Hosna Zare, Nooshin Sadat Ghiasi, Mohammad Ali Karimi, Mahdi Hosseini Bafghi (2025)
Júlia Morales Rodrigues, Ana Paula Ferreira Leal, Danieli Fernanda Buccini, Octavio Luiz Franco (2025)
+ 48 more citations
Related Resources
Quick Facts
Formula
C205H340N60O53
Molecular Weight
4493.33
Sequence
[LL-37, 37 aa]
Mechanism
Antimicrobial peptide with immune-modulating properties
Safety Information
Research compound only. Limited human safety data available.
Citations
53Mo Ahamad Khan, Lechen Zhu, Hu Zhu (2025)
Alireza Neshani, Hosna Zare, Nooshin Sadat Ghiasi, Mohammad Ali Karimi, Mahdi Hosseini Bafghi (2025)
Júlia Morales Rodrigues, Ana Paula Ferreira Leal, Danieli Fernanda Buccini, Octavio Luiz Franco (2025)
+ 48 more citations