Skip to main content
WADA Banned 4 views

IGF-1 DES

Truncated IGF-1 variant for localized muscle growth

IGF-1 DES molecular structure

WADA PROHIBITED - Not permitted in competitive sports

Overview

IGF-1 DES (Des(1-3)IGF-1) is a truncated form of insulin-like growth factor-1 lacking the first three N-terminal amino acids (glycine, proline, glutamate). This modification significantly alters the peptide's biological properties by dramatically reducing binding affinity to IGF binding proteins (IGFBPs). Since IGFBPs normally sequester and regulate IGF-1 activity, IGF-1 DES exhibits approximately 10-fold greater potency than native IGF-1 in stimulating cellular proliferation and protein synthesis. The truncated peptide acts primarily in an autocrine/paracrine fashion with rapid, potent local effects. Research demonstrates enhanced myogenic and mitogenic activity compared to standard IGF-1. IGF-1 DES has a very short half-life (20-30 minutes) due to rapid degradation, making it suitable for targeted local effects rather than systemic administration. The peptide is popular in research examining IGF-1 signaling and has been used experimentally for localized muscle growth applications. However, the enhanced potency also increases potential for adverse effects including hypoglycemia and must be used with appropriate caution.

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

Des(1-3)IGF-1Des(1-3)IGF-IDestripeptide IGF-1Truncated IGF-1tIGF-1
CAS56-53-1
PubChem448537

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

IGF-1 receptor signalingMyoblast proliferation and myogenesisMuscle cell culture modelsGrowth factor potency studies

Available Evidence

Human

No human clinical trials of IGF-1 DES were identified; it is not an approved medicine.

Animal

Published animal efficacy studies specifically on des(1-3)IGF-1 were not identified in this review; available evidence is primarily from cell-culture systems.

In Vitro

Cell-based studies established that removing the N-terminal tripeptide markedly reduces IGF-1's affinity for IGF-binding proteins, leaving more free ligand available to the IGF-1 receptor and making the peptide more potent in proliferation assays; des(1-3)IGF-I was also studied in cultured porcine embryonic muscle cells.

Uncertain

Claims of superior muscle-building potency and a very short half-life circulate widely in the peptide community but lack published human pharmacokinetic or clinical data.

Key Studies & Findings

2 studies
In Vitro1989

Research on the N-terminal region of IGF-1 established a key functional role for the first amino acids: the truncated derivative des(1-3)IGF-1 binds IGF-binding proteins far less avidly, increasing receptor availability and potency in cell assays.

In Vitro1999

In cultured porcine embryonic muscle cells, IGF-I and des(1-3)IGF-I differentially regulated IGF-binding protein-3, illustrating the truncated peptide's altered binding-protein interactions in muscle-relevant cells.

Benefits & Effects

3 documented

Enhanced muscle differentiation

anecdotalMuscle

Localized anabolic effects

anecdotalMuscle

Minimal IGFBP binding

anecdotalMuscle

Side Effects & Safety

3 reported

Hypoglycemia

SevereCommon Reversible

Onset: immediate

Narrow therapeutic window

SevereUncommon

Cytotoxic at high doses

SevereUncommon

Limitations & Open Questions

All solid evidence is in-vitro (cell culture). No human or robust animal trials of IGF-1 DES exist; common claims about localized muscle growth, dosing, and a 20-30 minute half-life are not backed by published clinical or pharmacokinetic studies.

Pharmacology

IGF-1 DES is des(1-3)IGF-1, an IGF-1 variant lacking the first three N-terminal amino acids; in cell studies its reduced IGFBP binding increases receptor availability. No approved human use, dose, or characterized human pharmacokinetics were found.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

low microgram ranges

Route: SC (localized)
Half-life: 20-30 minutes

Frequently Asked Questions

What makes IGF-1 DES different from regular IGF-1?

It lacks the first three N-terminal amino acids, which in cell studies greatly reduces its binding to IGF-binding proteins, increasing free ligand for the IGF-1 receptor.

Is IGF-1 DES approved for human use?

No. It is an unapproved research peptide with no human clinical trials.

Does IGF-1 DES have a short half-life?

Short half-life claims circulate widely but were not confirmed in published human pharmacokinetic studies found in this review.

Research Citations

Related Resources

Quick Facts

Formula

~7.4 kDa (67 AA)

Molecular Weight

7.6

Sequence

MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK

Mechanism

Fast-acting IGF-1 for localized muscle hypertrophy effects

Safety Information

Research compound only. ANGIOGENESIS/CANCER CONCERN - Potential tumor promotion. WADA BANNED. NOT approved for human use.

View All Peptides