FDA-approved prescribing information documents efficacy and approved indications of somatropin (Genotropin) across pediatric and adult GH-deficiency indications.
HGH (Human Growth Hormone)

WADA BANNED - Strictly prohibited in competitive sports at all times
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Somatropin is FDA-approved for pediatric growth disorders (GH deficiency, Turner syndrome, Prader-Willi syndrome, small for gestational age, idiopathic short stature, SHOX deficiency) and adult GH deficiency, with extensive clinical trial and post-marketing evidence. RCTs show improved height velocity in children and improved body composition, bone and cardiovascular risk markers in adults with GH deficiency.
Animal studies established the GH/IGF-1 axis biology underlying clinical use.
Use for 'anti-aging', athletic performance enhancement or bodybuilding is not FDA-approved; safety in these settings is not established and off-label use carries documented risks (fluid retention, glucose intolerance, arthralgia).
Key Studies & Findings
Weekly long-acting somatrogon (NGENLA) was approved for pediatric GH deficiency based on a phase 3 trial versus daily somatropin.
Benefits & Effects
Side Effects & Safety
Mild-Moderate side effect
Onset: Days-weeks
Management: Dose reduction
Dose-dependent
Mild-Moderate side effect
Onset: Days-weeks
Management: Dose reduction, analgesics
Dose-dependent
Moderate side effect
Onset: Weeks-months
Management: Dose reduction, treatment interruption, surgery (2%)
Dose-dependent
Moderate-Severe side effect
Onset: Weeks-months
Management: Monitor glucose; adjust antihyperglycemics
Dose-dependent
Severe side effect
Onset: First 8 weeks
Management: Discontinue; funduscopic exam
Dose-dependent
Moderate side effect
Onset: Weeks-months
Management: Monitor thyroid; replacement therapy
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
Medical use: 0.15-0.3mg daily | Research protocols: 1-4 IU daily depending on goals
Research Protocols
Medical GHD Replacement (Starting)
- Dose
- 0.15-0.3 mg/day (0.5-1 IU)
- Frequency
- Once daily
- Route
- SubQ injection
Medical GHD Replacement (Maintenance)
- Dose
- 0.4-0.8 mg/day (1.2-2.4 IU)
- Frequency
- Once daily
- Route
- SubQ injection
Anti-Aging / Wellness (Conservative)
- Dose
- 1-2 IU/day (0.33-0.67 mg)
- Frequency
- Once daily
- Route
- SubQ injection
Body Recomposition (Moderate)
- Dose
- 2-4 IU/day (0.67-1.33 mg)
- Frequency
- Once or twice daily
- Route
- SubQ injection
Performance (Higher - More Risk)
- Dose
- 4-8 IU/day (1.33-2.67 mg)
- Frequency
- Split twice daily
- Route
- SubQ injection
Fasted Morning Protocol
- Dose
- 2-4 IU
- Frequency
- Morning on empty stomach
- Route
- SubQ injection
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Is HGH legal to buy for anti-aging?
Somatropin is a prescription drug; use without a prescription (including for anti-aging or athletics) is illegal in most jurisdictions and not medically indicated.
What is HGH used for medically?
GH deficiency in children and adults and certain growth disorders, per FDA-approved labeling.
Research Citations
[hGH and molecular biology].
Goossens M (1986)
Bidlingmaier M, Strasburger CJ (2010)
Wang JJ, Chong QY, Sun XB, You ML, Pandey V, Chen YJ, Zhuang QS, Liu DX, Ma L, Wu ZS, Zhu T, Lobie PE (2017)
Sawada J, Wada N, Irie M, Tokunaga-Doi T, Ohtsuka E, Ikehara M, Terao T (1986)
Wada M, Uchida H, Ikeda M, Tsunekawa B, Naito N, Banba S, Tanaka E, Hashimoto Y, Honjo M (1998)
+ 44 more citations
Related Resources
Quick Facts
Formula
C13H11N5O3
Molecular Weight
22
Sequence
MATGSRTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
Mechanism
Directly stimulates protein synthesis, lipolysis, and gluconeogenesis through IGF-1 mediated pathways
Safety Information
FDA approved for GHD, Turner syndrome, CKD, PWS, HIV wasting, ISS. WADA BANNED. Requires medical supervision. Side effects include arthralgia, edema, carpal tunnel, glucose intolerance.
Citations
491.[hGH and molecular biology].
Goossens M (1986)
Bidlingmaier M, Strasburger CJ (2010)
Wang JJ, Chong QY, Sun XB, You ML, Pandey V, Chen YJ, Zhuang QS, Liu DX, Ma L, Wu ZS, Zhu T, Lobie PE (2017)
Sawada J, Wada N, Irie M, Tokunaga-Doi T, Ohtsuka E, Ikehara M, Terao T (1986)
Wada M, Uchida H, Ikeda M, Tsunekawa B, Naito N, Banba S, Tanaka E, Hashimoto Y, Honjo M (1998)
+ 44 more citations