An open-label study reported clinical benefit from repeated intravenous reduced glutathione in patients with early, untreated Parkinson's disease.
Glutathione
Master antioxidant for detoxification and cellular protection

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Supplement - Master antioxidant
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
An early open study reported clinical benefit from repeated IV reduced glutathione in early Parkinson's disease, though later trials are small and mixed. A 2024 randomized trial found that adding IV glutathione to ketamine therapy improved depression outcomes. Pharmacokinetic studies show oral glutathione is very poorly absorbed, a key limitation for oral supplementation.
Animal models link glutathione depletion to oxidative injury and show that glutathione or its precursors restore antioxidant capacity in conditions such as acetaminophen toxicity and neurodegeneration models.
Cell and biochemical studies establish glutathione as the major intracellular thiol antioxidant, directly scavenging reactive oxygen species and serving as a cofactor for glutathione peroxidases and transferases.
Consumer claims for oral or IV glutathione - skin lightening, 'detox', anti-aging, immune boosting - are not supported by robust clinical evidence; oral bioavailability is poor and IV use for these purposes is not FDA approved.
Key Studies & Findings
A pharmacokinetic study demonstrated very low systemic availability of orally administered glutathione in humans, undermining oral supplementation claims.
In a randomized trial in major depressive disorder, adding IV glutathione to standard ketamine therapy improved depression outcomes versus ketamine alone.
Benefits & Effects
Detoxifies liver
Improves skin health
Reduces oxidative stress.
Master antioxidant
Detoxifies liver
Improves skin health
Reduces oxidative stress.
There may be some absorption of glutathione intact from the intestines, but it cannot enter cells intact. It must be metabolized to form L-cystine (two molecules of L-cysteine bound together) before being taken up.
Provision of L-cysteine within the cell is all that is needed to increase glutathione synthesis, and N-Acetylcysteine does this efficiently at a lower financial cost than glutathione.
In effect, glutathione is an indirect and expensive way to provide dietary L-cysteine. Dietary protein itself, including L-cysteine rich sources such as Whey Protein, are effective but inefficient ways to increase L-cysteine intake in the diet and N-Acetylcysteine is both more efficient and cheaper than glutathione.
Although oral glutathione supplementation does not efficiently increase intracellular glutathione levels for the above reasons, it can be absorbed intact into the blood stream. Since increased glutathione levels in the blood have been shown to slow the breakdown of nitric oxide, glutathione supplementation may be useful to augment nitric oxide boosters such as L-Citrulline or L-Arginine.
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
Supplement protocols: 250-1000mg daily (consult healthcare provider)
Research Protocols
General antioxidant support
- Dose
- 200-400 mg
- Frequency
- 1-2x weekly
- Route
- IM or IV push
Detoxification support
- Dose
- 400-600 mg
- Frequency
- 2-3x weekly
- Route
- IV push or slow infusion
Immune support
- Dose
- 400-600 mg
- Frequency
- 1-2x weekly
- Route
- IV or IM
Neurological support (Parkinson's research)
- Dose
- 1400 mg
- Frequency
- 3x weekly
- Route
- IV infusion (clinical protocol)
Maintenance
- Dose
- 200 mg
- Frequency
- 1x weekly
- Route
- IM or SubQ
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Does oral glutathione work?
Evidence shows oral glutathione is very poorly absorbed (low systemic bioavailability), so most oral products are unlikely to meaningfully raise plasma glutathione.
Is IV glutathione FDA approved?
IV glutathione is not FDA approved for skin lightening, detox, or anti-aging uses; approved indications for glutathione-related products are limited.
What is the Parkinson's disease evidence?
An early open study (1996) reported benefit from IV glutathione in early Parkinson's disease; subsequent trials are small and mixed, so it is not an established treatment.
Research Citations
Oestreicher J, Morgan B (2019)
Gnanasekaran P, Pappu HR (2023)
Hinchman CA, Ballatori N (1994)
Niitsu Y, Sato Y, Takayama T (2022)
Hepatic glutathione and glutathione S-conjugate transport mechanisms.
Lee TK, Li L, Ballatori N (1997)
+ 20 more citations
Related Resources
Quick Facts
Formula
C10H17N3O6S
Molecular Weight
0.307
Sequence
MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF
Mechanism
Master antioxidant that neutralizes free radicals and supports detoxification
Safety Information
Generally considered safe as a supplement. Consult healthcare provider for appropriate dosing.
Citations
25Oestreicher J, Morgan B (2019)
Gnanasekaran P, Pappu HR (2023)
Hinchman CA, Ballatori N (1994)
Niitsu Y, Sato Y, Takayama T (2022)
5.Hepatic glutathione and glutathione S-conjugate transport mechanisms.
Lee TK, Li L, Ballatori N (1997)
+ 20 more citations