Skip to main content
10 views

Cortexin

Brain peptide complex for neuroprotection and cognitive enhancement

Cortexin molecular structure

Overview

Cortexin is a neuropeptide complex extracted from cattle brain cortex containing low-molecular-weight peptides and amino acids with neurotrophic and neuroprotective properties. Used extensively in Russia and Eastern European countries, Cortexin is approved for treatment of various neurological conditions including stroke, traumatic brain injury, encephalopathy, and cognitive disorders. Research demonstrates the preparation supports neuronal metabolism, reduces neuroinflammation, modulates neurotransmitter balance, and promotes functional recovery after brain injury. Clinical studies show improvements in cognitive function, memory, attention, and neurological recovery in various patient populations. The peptide complex is administered intramuscularly and is proposed to cross the blood-brain barrier to exert central effects. Cortexin contains multiple bioactive components that may act synergistically on neuronal tissue. While widely used clinically in some countries, the preparation lacks large-scale randomized controlled trials meeting Western regulatory standards. Research continues into its mechanisms of action and potential applications for neurodegenerative diseases and age-related cognitive decline.

Last reviewed: 2026-08-18

Identity & Aliases

Also known as

КортексинPolypeptide preparation of mammalian brain cortexBovine cortex polypeptide complex

Full composition (formula, molecular weight, sequence) in Quick Facts →

Research Areas

Neuroprotection and neurorehabilitationPediatric cerebral palsy rehabilitationCognitive recovery after brain injuryNootropic effects

Available Evidence

Human

Cortexin is a registered drug in Russia and several former-USSR countries. Small randomized trials (mostly Russian-language) report benefit as part of rehabilitation in children with cerebral palsy and as a neuroprotective adjunct; large Western-standard trials are lacking.

Animal

Preclinical studies report neuroprotective, antioxidant and neurotrophic-like effects in animal models of brain injury.

Uncertain

Mechanism of action is poorly characterized (heterogeneous peptide mixture); English-language evidence is sparse and dosing regimens vary by local practice.

Key Studies & Findings

2 studies

Benefits & Effects

5 documented

Neuroprotection

anecdotalCognitive

Stroke recovery support

anecdotalCognitive

Cognitive enhancement

anecdotalCognitive

Memory improvement

anecdotalCognitive

Neurological function stabilization

anecdotalCognitive

Side Effects & Safety

3 reported

Injection site reactions

mildRare Reversible

Onset: immediate

Allergic reactions (rare)

moderateRare Reversible

Well-tolerated

mildCommon Reversible

Limitations & Open Questions

Small sample sizes; publications are mostly Russian-language with limited independent replication; Cortexin is a complex, incompletely characterized peptide mixture with manufacturing standardization questions; no robust Western clinical trials; pharmacokinetic documentation is poor.

Pharmacology

Administered intramuscularly as a registered Russian drug. It is a complex of low-molecular-weight polypeptides isolated from mammalian (bovine/pig) cerebral cortex. Pharmacokinetic data (half-life, bioavailability) are not well documented in accessible literature.

Reported Research Dosing

Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.

10-20mg per day, 5-10 days

Half-life: Variable (neuropeptide mixture)

Frequently Asked Questions

Is Cortexin FDA-approved?

No. It is registered as a pharmaceutical in Russia and some other countries, but not approved by the FDA.

What is Cortexin made of?

A complex of low-molecular-weight polypeptides extracted from mammalian brain cortex tissue.

Research Citations

4
Cortexin modulates OPG/RANK/RANKL and TRPC1 expression in cerebral ischemia-reperfusion injury.

Guven C, Türk A, Koçak S, Zencirci B, Yalcin A, Aydın H, Doğukan M (2025)

5

[Influence of cortexin on memory and attention].

Tsyganov VN, Bogoslovskiĭ MM (2004)

+ 21 more citations

Related Resources

Quick Facts

Molecular Weight

2.3

Sequence

MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMPTSTWADGLEGLEKGQFDHALA

Mechanism

Neuroprotective brain peptide complex for cognitive enhancement

Safety Information

Approved in Russia for neurological conditions. NOT FDA approved. Research compound elsewhere.

View All Peptides