In 22 sarcoidosis patients with small fiber neuropathy, ARA-290 (2 mg IV 3x/week for 4 weeks) significantly improved neuropathic symptom scores (SFNSL) and SF-36 pain/physical functioning vs placebo with no safety concerns.
ARA-290
Tissue-protective peptide for neuropathy and inflammatory conditions

Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Research compound - EPO derivative
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Randomized, double-blind, placebo-controlled pilot trial in 22 sarcoidosis patients with small fiber neuropathy found 4 weeks of intravenous ARA-290 (2 mg, 3x/week) significantly improved the Small Fiber Neuropathy Screening List score and SF-36 pain/physical functioning vs placebo. A phase 2 study in type 2 diabetes (28 days of daily subcutaneous 4 mg) reported improved neuropathic symptoms (PainDetect), improved HbA1c and lipid profiles, and increased corneal nerve fiber density in subjects with low baseline CNFD.
Preclinical neuropathy models showed ARA-290 reduces allodynia, and the peptide's tissue-protective, anti-inflammatory signaling via the innate repair receptor (EPO receptor/CD131 heteromer) was established in rodent injury models.
Cell-based studies established selective activation of the innate repair receptor without erythropoietin receptor homodimer activation, explaining the absence of erythropoiesis stimulation.
Long-term effects, optimal dosing/duration for neuropathy, and benefit in conditions beyond sarcoidosis and diabetic neuropathy remain unproven; no regulatory approval has been granted.
Key Studies & Findings
Phase 2 study in type 2 diabetes: 28 days of daily SC ARA-290 (4 mg) improved PainDetect neuropathic symptoms, HbA1c and lipids, and increased corneal nerve fiber density in subjects with low baseline CNFD.
Preclinical neuropathy models demonstrated ARA-290 reduces allodynia by activating the innate repair receptor, establishing the mechanism for its tissue-protective and analgesic effects.
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
1-4mg 3x weekly
Research Protocols
Neuropathy Treatment
- Dose
- 4 mg daily
- Frequency
- Once daily
- Route
- Subcutaneous
Tissue Protection
- Dose
- 1-8 mg daily
- Frequency
- Once daily
- Route
- Subcutaneous
Acute Intervention
- Dose
- 2 mg
- Frequency
- 3x weekly
- Route
- Intravenous
Research Protocol
- Dose
- 4 mg daily
- Frequency
- Once daily for 28 days
- Route
- Subcutaneous
Research protocols are for educational purposes only. Always consult qualified medical professionals.
Frequently Asked Questions
Is ARA-290 the same as erythropoietin?
No. ARA-290 (cibinetide) is an 11-amino-acid peptide engineered from EPO that activates only the tissue-protective innate repair receptor, not the erythropoiesis-stimulating EPO receptor homodimer.
Has ARA-290 been studied for small fiber neuropathy?
Yes — in a randomized, double-blind, placebo-controlled pilot trial in sarcoidosis patients with small fiber neuropathy, and in a phase 2 study in type 2 diabetes, both showing improved neuropathic symptoms.
Is ARA-290 approved by any regulator?
No. ARA-290/cibinetide remains an investigational compound with no FDA or EMA approval.
Research Citations
Mohtavinejad N, Hajiramezanali M, Akhlaghi M, Bitarafan-Rajabi A, Gholipour N (2021)
van Velzen M, Heij L, Niesters M, Cerami A, Dunne A, Dahan A, Brines M (2014)
Al-Onaizi MA, Thériault P, Lecordier S, Prefontaine P, Rivest S, ElAli A (2022)
+ 41 more citations
Related Resources
Quick Facts
Formula
C51H84N16O21
Molecular Weight
2.9
Sequence
MKPFCVFLTFFLLLAASSKKVDSAETVSFNFNSFSEGNPAINFQGDVTVLSNGNIQLTNLNKVNSVGRVLYAMPVRIWSSATGNVASFLTSFSFEMKDIKDYDPADGIIFFIAPEDTQIPAGSIGGGTLGVSDTKGAGHFVGVEFDTYSNSEYNDPPTDHVGIDVNSVDSVKTVPWNSVSGAVVKVTVIYDSSTKTLSVAVTNDNGDITTIAQVVDLKAKLPERVKFGFSASGSLGGRQIHLIRSWSFTSTLITTTRRSIDNNEKKIMNMASA
Mechanism
Non-erythropoietic EPO derivative for tissue protection and neuropathy
Safety Information
Research compound only. Limited human safety data available.
Citations
46Mohtavinejad N, Hajiramezanali M, Akhlaghi M, Bitarafan-Rajabi A, Gholipour N (2021)
van Velzen M, Heij L, Niesters M, Cerami A, Dunne A, Dahan A, Brines M (2014)
Zhang W, Yu G, Zhang M (2016)
Al-Onaizi MA, Thériault P, Lecordier S, Prefontaine P, Rivest S, ElAli A (2022)
+ 41 more citations