AICAR plus a PPARδ agonist increased running endurance ~44% in sedentary mice without exercise training, establishing AMPK activation as an exercise-mimetic pathway.
AICAR
AMPK activator for endurance enhancement and metabolic optimization

WADA BANNED - Prohibited in competitive sports as metabolic modulator
Overview
Last reviewed: 2026-08-18
Identity & Aliases
Also known as
Status: Research compound - AMPK activator
Full composition (formula, molecular weight, sequence) in Quick Facts →
Research Areas
Available Evidence
Acadesine was studied in clinical trials as an adenosine-regulating agent to protect the heart during coronary artery bypass grafting; the randomized RED-CABG trial (JAMA 2012) showed no benefit on morbidity/mortality, and acadesine was never approved.
In sedentary mice, AICAR combined with the PPARδ agonist GW1516 increased running endurance by ~44% without training, the landmark 'exercise mimetic' finding (Narkar et al., Cell 2008); AICAR also increases skeletal-muscle glucose uptake and mitochondrial content in rodent models.
AICAR is phosphorylated intracellularly to ZMP, an AMP analog that allosterically activates AMPK; in cultured muscle cells it enhances glucose uptake and fatty-acid oxidation.
Claims that AICAR delivers human performance or endurance benefits are speculative — human trials targeted cardiac ischemia, not performance, and failed; oral use is not evidence-based.
Key Studies & Findings
The RED-CABG randomized trial found the adenosine-regulating agent acadesine had no significant effect on morbidity or mortality after coronary artery bypass grafting.
A meta-analysis of five international randomized trials found no benefit of acadesine on myocardial infarction, stroke, or death following cardiac surgery.
Benefits & Effects
Side Effects & Safety
Limitations & Open Questions
Pharmacology
Reported Research Dosing
Reported values from research literature and community protocols. Educational reference only — not a dosing recommendation or medical advice.
50-500mg IV/SC
Frequently Asked Questions
Is AICAR (acadesine) approved for human use?
No. It is not FDA-approved for any indication; clinical development for cardiac surgery was discontinued after trials showed no benefit.
Does AICAR actually mimic exercise in humans?
The exercise-mimetic effect is documented in mice (Narkar et al., 2008). No human study has demonstrated endurance or performance benefits.
Research Citations
Pawel Tomasz Musial, Piotr Arkadiusz Badtke, Magdalena Agnieszka Zabielska-Kaczorowska (2025)
Chen Huimin, Peng Shufen, Cui Zhaoyu, Liu Jiaxin, Chen Li (2025)
T Piper, H Geyer, F Huelsemann, U Mareck, K Walpurgis (2025)
Višnjić D, Lalić H, Dembitz V, Tomić B, Smoljo T (2021)
+ 24 more citations
Related Resources
Quick Facts
Formula
C9H14N4O5
Molecular Weight
258.23
Sequence
MAPGQLALFSVSDKTGLVEFARNLTALGLNLVASGGTAKALRDAGLAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMARLDFNLIRVVACNLYPFVKTVASPGVTVEEAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGVSQMPLRYGMNPHQTPAQLYTLQPKLPITVLNGAPGFINLCDALNAWQLVKELKEALGIPAAASFKHVSPAGAAVGIPLSEDEAKVCMVYDLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH
Mechanism
AMPK activator for endurance and metabolic benefits
Safety Information
Research compound only. Limited human safety data available.
Citations
29Pawel Tomasz Musial, Piotr Arkadiusz Badtke, Magdalena Agnieszka Zabielska-Kaczorowska (2025)
Chen Huimin, Peng Shufen, Cui Zhaoyu, Liu Jiaxin, Chen Li (2025)
T Piper, H Geyer, F Huelsemann, U Mareck, K Walpurgis (2025)
Višnjić D, Lalić H, Dembitz V, Tomić B, Smoljo T (2021)
+ 24 more citations